PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010092480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 369aa    MW: 41015.6 Da    PI: 8.3457
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010092480.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-333286155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  XP_010092480.1 32 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 86
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-322987IPR009057Homeodomain-like
PROSITE profilePS5129412.3472989IPR017930Myb domain
SuperFamilySSF466891.7E-163187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-233287IPR006447Myb domain, plants
PfamPF002491.2E-73484IPR001005SANT/Myb domain
PfamPF143793.2E-25127173IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MFQHKKPSTM NSHDRPMCVQ GDSGLVLTTD PKPRLRWTVE LHERFVDAVT QLGGPDKATP  60
KTIMRVMGVK GLTLYHLKSH LQKFRLGKQP HKEFNDHSIK DASALELQRN TASSSGMISR  120
SMNDNSHIVD AIRMQMEVQR RLHEQLEVQK HLQLRIEAQG KYMQSILEKA CQTLAGENSM  180
ASAAGNYKGS IVNHGVNPHD MGTLKDFTAP LGFPSFQDLN IYGGDQLDLQ QSMDRPSIDH  240
GFLPNNDNLC LGKKRPSPYN GSTGKSPLMW SDDLRLQDLG TAASCLGPPD HDPFKGDQIQ  300
MAPPSIERGT EIDSLSDIYE TKPVISGEHM GEKKYDVAGA KLERPSPRRV PLAGERMSPM  360
IQGRNSPFG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010092480.10.0Myb family transcription factor APL
SwissprotQ9SAK51e-129APL_ARATH; Myb family transcription factor APL
TrEMBLW9R1F00.0W9R1F0_9R
STRINGVIT_19s0085g00890.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49643252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-130G2-like family protein